Pfam domain
Pfam family: MCM_N (PF14551.8)
Uniprot AC: Q9V461
RecName: DNA replication licensing factor Mcm6
Begin-End: 22-124
Organism: Drosophila melanogaster
Interaction Mode:   

Sequence:
QKLFQDFLEEFKEDGEIKYTRPAASLESPDRCTLEVSFEDVEKYDQNLATAIIEEYYHIY
PFLCQSVSNYVKDRIGLKTQKDCYVAFTEVPTRHKVRDLTTSK
Structures of the domain Q9V461 22-124
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rax X-ray 3.99 6 22-125 None
6ray X-ray 4.28 6 22-121 None
6raw X-ray 3.7 6 22-125 None
6raz X-ray 4.46 6 22-125 None


© NPIDB team 2003 - 2021

text