Pfam domain
Pfam family: MCM_lid (PF17855.3)
Uniprot AC: Q9V461
RecName: DNA replication licensing factor Mcm6
Begin-End: 562-648
Organism: Drosophila melanogaster
Interaction Mode:   

Sequence:
EEVLRYVTFARQFKPVISQEAGHMLVENYGHLRQRDTGTSGRSTWRITVRQLESMIRLSE
AMAKLECSNRVLERHVKEAFRLLNKSI
Structures of the domain Q9V461 562-648
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rax X-ray 3.99 6 562-648 None
6ray X-ray 4.28 6 562-648 None
6raw X-ray 3.7 6 562-648 None
6raz X-ray 4.46 6 562-648 None


© NPIDB team 2003 - 2021

text