Pfam domain
Pfam family: Sld5 (PF05916.13)
Uniprot AC: Q9VBI1
RecName: DNA replication complex GINS protein SLD5
Begin-End: 22-138
Organism: Drosophila melanogaster
Interaction Mode:   

Sequence:
LEDEDDDDMEQITAQKVLEIIETAWINEMCAPEILPSQTDMLELMVSQVAHMEEQMRDLD
KNDFRAVVHSMELERVRYIMASYLRCRLQKIETFTQHILNQEESREPDDKRLSPEET
Structures of the domain Q9VBI1 22-138
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rax X-ray 3.99 N 24-138 None
6ray X-ray 4.28 N 24-150 None
6raw X-ray 3.7 N 24-138 None
6raz X-ray 4.46 N 23-138 None


© NPIDB team 2003 - 2021

text