Pfam domain
Pfam family: MCM_OB (PF17207.5)
Uniprot AC: Q9VGW6
RecName: DNA replication licensing factor Mcm5
Begin-End: 131-268
Organism: Drosophila melanogaster
Interaction Mode:   

Sequence:
NIRQLKSDCVSKLVKIAGIIVAASGISAKATRMSIQCLSCSTVIPNLKVNPGLEGYALPR
KCNTEQAGRPKCPLDPFFIMPDKCKCVDFQTLKLQELPDFVPQGEIPRHLQLFCDRSLCE
RVVPGNRVLIQGIYSIRK
Structures of the domain Q9VGW6 131-268
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rax X-ray 3.99 5 131-268 None
6ray X-ray 4.28 5 131-268 None
6raw X-ray 3.7 5 131-268 None
6raz X-ray 4.46 5 131-268 None


© NPIDB team 2003 - 2021

text