Pfam domain
Pfam family: MCM_N (PF14551.8)
Uniprot AC: Q9VGW6
RecName: DNA replication licensing factor Mcm5
Begin-End: 31-125
Organism: Drosophila melanogaster
Interaction Mode:   

Sequence:
KKKYKEFIRTFNEENFFYKYRDTLKRNYLNGRYFLEIEMEDLVGFDETLADKLNKQPTEH
LEIFEEAAREVADEITAPRPEHEEHMHDIQILLSS
Structures of the domain Q9VGW6 31-125
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rax X-ray 3.99 5 31-125 None
6ray X-ray 4.28 5 31-127 None
6raw X-ray 3.7 5 31-125 None
6raz X-ray 4.46 5 31-128 None


© NPIDB team 2003 - 2021

text