Pfam domain
Pfam family: Piwi (PF02171.19)
Uniprot AC: Q9VKM1
RecName: Protein piwi
Begin-End: 538-829
Organism: Drosophila melanogaster
Interaction Mode:   

Sequence:
LILCLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKTTKNRSLMSIATKIAIQLNCKLGYT
PWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNSTYFSTVTECSAFDVLANT
LWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFEVKDIIEKLKTEYARVQLS
PPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYN
VLYSSMGLSPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLVGTNLH
Structures of the domain Q9VKM1 538-829
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kr6 X-ray 2.9 A 538-829 None


© NPIDB team 2003 - 2021

text