Pfam domain
Pfam family: Sld5 (PF05916.13)
Uniprot AC: Q9VQY9
RecName: Probable DNA replication complex GINS protein PSF2
Begin-End: 42-153
Organism: Drosophila melanogaster
Interaction Mode:   

Sequence:
VFVPLWMATHLRKQQKCRIVPPEWMDMDILEEIKEEEKRSKFFTKMPCEHYMVVAQLVMS
TAPDDVPRCEELRTVIKDIFDIRESKLRTSIDAFIKGEGTYAKLDNLTLLEI
Structures of the domain Q9VQY9 42-153
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rax X-ray 3.99 L 42-153 None
6ray X-ray 4.28 L 42-153 None
6raw X-ray 3.7 L 42-153 None
6raz X-ray 4.46 L 42-153 None


© NPIDB team 2003 - 2021

text