Pfam domain
Pfam family: Sld5 (PF05916.13)
Uniprot AC: Q9W2V7
RecName: AT18545p
Begin-End: 52-158
Organism: Drosophila melanogaster
Interaction Mode:   

Sequence:
VNLPLWYIKELKVNNAYFTVAVPDIYRNVHKAVCEAETTHIELGRLHPYFYEFGRYLTPY
DRNHVIGRIIFETLRQRVRHLLDISKSDGQAAKAEHRLDNIEAKLHE
Structures of the domain Q9W2V7 52-158
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rax X-ray 3.99 M 52-157 None
6ray X-ray 4.28 M 52-157 None
6raw X-ray 3.7 M 52-157 None
6raz X-ray 4.46 M 52-169 None


© NPIDB team 2003 - 2021

text