Pfam domain
Pfam family: RNase_HII (PF01351.20)
Uniprot AC: Q9X017
RecName: Ribonuclease HII
Begin-End: 15-188
Organism: Thermotoga maritima
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 

Sequence:
AGVDEAGRGCLAGPVVAAAVVLEKEIEGINDSKQLSPAKRERLLDEIMEKAAVGIGIASP
EEIDLYNIFNATKLAMNRALENLSVKPSFVLVDGKGIELSVPGTCLVKGDQKSKLIGAAS
IVAKVFRDRLMSEFHRMYPQFSFHKHKGYATKEHLNEIRKNGVLPIHRLSFEPV
Structures of the domain Q9X017 15-188
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3o3g X-ray 2.1 A 15-188  H-Bb S-Bb L-Bb L-Mj L-Mn 
3o3h X-ray 2.8 A 15-188  H-Bb H-Mj S-Bb L-Bb 
3o3f X-ray 2 A 15-188  H-Bb H-Mj S-Bb L-Bb L-Mn 
4hht X-ray 3.1 A 15-188  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2021

text