Pfam domain
Pfam family: TetR_N (PF00440.25)
Uniprot AC: Q9X0C0
RecName: Transcriptional regulator, TetR family
Begin-End: 8-54
Organism: Thermotoga maritima
Interaction Mode:   

Sequence:
ILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQA
Structures of the domain Q9X0C0 8-54
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4i6z X-ray 3.2 B 8-54  H-Bb H-Mj L-Bb L-Mj 
4i6z X-ray 3.2 A 8-54  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text