Pfam domain
Pfam family: DNA_pol3_alpha (PF07733.14)
Uniprot AC: Q9XDH5
RecName: DNA polymerase III subunit alpha
Begin-End: 355-621
Organism: Thermus aquaticus
Interaction Mode:   

Sequence:
ARVEEKAWEELRKRLPPLEGVREWTAEAILHRALYELSVIERMGFPGYFLIVQDYINWAR
GHGVSVGPGRGSAAGSLVAYAVGITNIDPLRFGLLFERFLNPERVSMPDIDTDFSDRERD
RVIQYVRERYGEDKVAQIGTFGSLASKAALKDVARVYGIPHKKAEELAKLIPVQFGKPKP
LQEAIQVVPELRAEMEKDERIRQVIEVAMRLEGLNRHASVHAAGVVIAAEPLTDLVPLMR
DQEGRPVTQYDMGAVEALGLLKMDFLG
Structures of the domain Q9XDH5 355-621
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3e0d X-ray 4.6 B 352-621  H-Bb S-Bb L-Bb L-Mn 
3e0d X-ray 4.6 A 352-621  H-Bb S-Bb L-Bb L-Mj L-Mn 
4iqj X-ray 3.2 D 352-621 None
4iqj X-ray 3.2 B 351-621 None
4iqj X-ray 3.2 C 352-621 None
4iqj X-ray 3.2 A 352-621  L-Bb L-Mj 


© NPIDB team 2003 - 2021

text