Pfam domain
Pfam family: HHH_6 (PF14579.8)
Uniprot AC: Q9XDH5
RecName: DNA polymerase III subunit alpha
Begin-End: 865-953
Organism: Thermus aquaticus
Interaction Mode:   

Sequence:
GIPVLPPDVNRSGFDFKVVGEEILFGLSAVKNVGEMAARAILEERERGGPFKSLGDFLKR
LPEQVVNKRALESLVKAGALDAFGDRARL
Structures of the domain Q9XDH5 865-953
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3e0d X-ray 4.6 B 865-953  H-Bb L-Bb 
3e0d X-ray 4.6 A 865-953 None
4iqj X-ray 3.2 D 865-953  L-Bb 
4iqj X-ray 3.2 A 865-953 None
4iqj X-ray 3.2 C 865-953 None
4iqj X-ray 3.2 B 865-953 None


© NPIDB team 2003 - 2021

text