Pfam domain
Pfam family: Phage_antitermQ (PF06530.14)
Uniprot AC: Q9XJQ6
RecName: Q protein
Begin-End: 12-124
Organism: Phage 21
Interaction Mode:   

Sequence:
QHEWLNGWLELWAHGLSGRLEKRMSSVIAKFMESIEPGRVMTRPMCNDDDGMLISQVVDS
VMYIDKKAFGILLSYYAHGSSKHAIASYYHRVARPRKMLCRGGGRIQKPSLAT
Structures of the domain Q9XJQ6 12-124
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6p18 X-ray 3.5 Q 15-103  H-Bb H-Mj 
6p18 X-ray 3.5 P 15-103  H-Bb H-Mj 
6p19 X-ray 3.8 Q 15-104 None
6p1a X-ray 2.84 B 15-103  H-Bb H-Mj L-Bb 
6p1a X-ray 2.84 A 15-103  H-Bb H-Mj L-Bb 
6p1a X-ray 2.84 C 15-103  H-Bb H-Mj 


© NPIDB team 2003 - 2021

text