Pfam domain
Pfam family: MCM_N (PF14551.8)
Uniprot AC: Q9XYU0
RecName: DNA replication licensing factor Mcm7
Begin-End: 10-140
Organism: Drosophila melanogaster
Interaction Mode:   

Sequence:
RESIKTFLSEFCKCDDDGKKEFVYGSQLVKLAHREQVLITIDLDDLAEFNESLAEAVVDN
CRRYTSIFSDVIAELLPSYKQQEVHAKDALDVYIEHRLMMESRTRNPMEQRDERNSFPSE
LMKRFEVGFKP
Structures of the domain Q9XYU0 10-140
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rax X-ray 3.99 7 10-136 None
6ray X-ray 4.28 7 10-140 None
6raw X-ray 3.7 7 10-136 None
6raz X-ray 4.46 7 10-147 None


© NPIDB team 2003 - 2021

text