Pfam domain
Pfam family: MCM (PF00493.25)
Uniprot AC: Q9XYU0
RecName: DNA replication licensing factor Mcm7
Begin-End: 320-541
Organism: Drosophila melanogaster
Interaction Mode:   

Sequence:
TPEELEELAQDDFYERLATSLAPEIYGHLDVKKALLLLLVGGVDKRPDGMKIRGNINICL
MGDPGVAKSQLLGYISRLAVRSQYTTGRGSSGVGLTAAVMKDPLTGEMTLEGGALVLADQ
GVCCIDEFDKMADQDRTAIHEVMEQQTISIAKAGIMTTLNARVSILAAANPAFGRYNPRR
TVEQNIQLPAALLSRFDLLWLIQDKPDRDNDLRLAKHITYVH
Structures of the domain Q9XYU0 320-541
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rax X-ray 3.99 7 316-537 None
6ray X-ray 4.28 7 291-541 None
6raw X-ray 3.7 7 316-537 None
6raz X-ray 4.46 7 321-541 None


© NPIDB team 2003 - 2021

text