Pfam domain
Pfam family: MCM_OB (PF17207.5)
Uniprot AC: Q9XYU1
RecName: DNA replication licensing factor Mcm3
Begin-End: 107-242
Organism: Drosophila melanogaster
Interaction Mode:   

Sequence:
HVTPRSLTSIYLGNMVCVEGIVTKVSLIRPKVVRSVHYCPNTRKVMERKYTDLTSFEAVP
SGAAYPTKDEDGNLLETEYGLSVYKDHQTLTIQEMPEKAPAGQLPRSVDIVCDDDLVDRC
KPGDRVQIVGSYRCLP
Structures of the domain Q9XYU1 107-242
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rax X-ray 3.99 3 107-242 None
6ray X-ray 4.28 3 107-242 None
6raw X-ray 3.7 3 107-242 None
6raz X-ray 4.46 3 107-242 None


© NPIDB team 2003 - 2021

text