Pfam domain
Pfam family: MCM (PF00493.25)
Uniprot AC: Q9XYU1
RecName: DNA replication licensing factor Mcm3
Begin-End: 277-500
Organism: Drosophila melanogaster
Interaction Mode:   

Sequence:
DIMLCKKLAKNNDIFELLSKSLAPSIHGHAYVKQAILCLLLGGVEKILPNGTRLRGDINV
LLIGDPSVAKSQLLRYVLNTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLA
DRGVVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHASLNARCSVLAAANPVYGRYDQ
YKTPMENIGLQDSLLSRFDLLFVMLDVIDSDVDQMISDHVVRMH
Structures of the domain Q9XYU1 277-500
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rax X-ray 3.99 3 277-500 None
6ray X-ray 4.28 3 277-500 None
6raw X-ray 3.7 3 277-500 None
6raz X-ray 4.46 3 277-500 None


© NPIDB team 2003 - 2021

text