Pfam domain
Pfam family: Sld5 (PF05916.13)
Uniprot AC: Q9Y248
RecName: DNA replication complex GINS protein PSF2
Begin-End: 42-153
Organism: Homo sapiens
Interaction Mode:   

Sequence:
VEVPLWLAINLKQRQKCRLLPPEWMDVEKLEKMRDHERKEETFTPMPSPYYMELTKLLLN
HASDNIPKADEIRTLVKDMWDTRIAKLRVSADSFVRQQEAHAKLDNLTLMEI
Structures of the domain Q9Y248 42-153
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6xtx X-ray 3.29 B 42-153 None


© NPIDB team 2003 - 2021

text