Pfam domain
Pfam family: IMS_C (PF11799.10)
Uniprot AC: Q9Y253
RecName: DNA polymerase eta
Begin-End: 316-432
Organism: Homo sapiens
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb L-Mj 

Sequence:
PKTIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGD
KRLSSLRRCCALTRYDAHKMSHDAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
Structures of the domain Q9Y253 316-432
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4o3s X-ray 1.72 A 316-432  H-Bb S-Bb L-Bb L-Mj 
5kfg X-ray 1.55 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
4j9l X-ray 1.85 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
6mp3 X-ray 1.91 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
4ect X-ray 1.79 A 316-432  H-Bb S-Bb S-Mj L-Bb 
5ewg X-ray 1.75 A 316-432  H-Bb S-Bb S-Mj L-Bb 
4ecr X-ray 1.89 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
5kfa X-ray 1.51 A 316-432  H-Bb S-Bb S-Mj L-Bb 
5dqg X-ray 2.29 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
5kfv X-ray 1.6 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
4o3n X-ray 1.58 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
5dg7 X-ray 2.26 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
4j9o X-ray 2.6 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
3mr5 X-ray 1.8 A 316-432  H-Bb S-Bb L-Bb 
5kfu X-ray 1.55 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
4ed2 X-ray 1.71 A 316-432  H-Bb S-Bb S-Mj L-Bb 
6pz3 X-ray 2.4 A 316-432  H-Bb S-Bb L-Bb 
6d0z X-ray 1.75 A 316-432  H-Bb S-Bb L-Bb 
4ed8 X-ray 1.52 A 316-432  H-Bb S-Bb S-Mj L-Bb 
5kg6 X-ray 1.55 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
6m7p X-ray 1.75 A 316-432  S-Bb S-Mj L-Bb 
5kfj X-ray 1.7 A 316-432  H-Bb S-Bb S-Mj L-Bb 
3si8 X-ray 2.15 A 316-430  H-Bb S-Bb S-Mj L-Bb 
4rnn X-ray 1.81 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
4rno X-ray 2.82 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
4dl2 X-ray 2.15 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
4ed3 X-ray 1.79 A 316-432  H-Bb S-Bb L-Bb 
3mr2 X-ray 1.83 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
3tq1 X-ray 2.56 A 316-432  H-Bb S-Bb L-Bb 
3mr3 X-ray 1.75 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
3jaa X-ray 22 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
3mr6 X-ray 1.9 A 316-432  S-Bb L-Bb L-Mj 
4ecv X-ray 1.52 A 316-432  H-Bb S-Bb S-Mj L-Bb 
6d0m X-ray 1.83 A 316-432  H-Bb S-Bb L-Bb 
4ecy X-ray 1.94 A 316-432  H-Bb S-Bb S-Mj L-Bb 
4ed6 X-ray 2.21 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
4ecz X-ray 1.83 A 316-432  H-Bb S-Bb L-Bb 
4ecq X-ray 1.5 A 316-432  H-Bb S-Bb S-Mj L-Bb 
4ecs X-ray 1.95 A 316-432  H-Bb S-Bb S-Mj L-Bb 
4ecx X-ray 1.74 A 316-432  H-Bb S-Bb S-Mj L-Bb 
4ecw X-ray 1.9 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
4ed1 X-ray 1.81 A 316-432  H-Bb S-Bb S-Mj L-Bb 
4ed0 X-ray 1.65 A 316-432  H-Bb S-Bb S-Mj L-Bb 
4ed7 X-ray 1.72 A 316-432  H-Bb S-Bb L-Bb 
4ecu X-ray 1.95 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
5l1k X-ray 1.82 A 316-432  H-Bb S-Bb L-Bb L-Mj 
5l1l X-ray 1.62 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
4rnm X-ray 2.14 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
4dl6 X-ray 2.5 A 316-432  H-Bb S-Bb S-Mj L-Bb 
4j9p X-ray 2.3 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
4eey X-ray 2.32 A 316-432  H-Bb S-Bb S-Mj L-Bb 
4dl7 X-ray 1.97 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
4j9q X-ray 1.96 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
4dl3 X-ray 2.1 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
4dl4 X-ray 2 A 316-432  S-Bb S-Mj L-Bb L-Mj 
4j9s X-ray 1.95 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
4j9n X-ray 1.96 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
4j9k X-ray 2.03 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
5kfn X-ray 1.45 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
4j9m X-ray 2.25 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
4j9r X-ray 2.35 A 316-432  H-Bb S-Bb S-Mj L-Bb 
5kg4 X-ray 1.6 A 316-432  H-Bb S-Bb L-Bb L-Mj 
6q02 X-ray 2.09 A 316-432  H-Bb S-Bb L-Bb 
6m7v X-ray 3.06 A 316-430  S-Bb L-Bb L-Mj 
5kfx X-ray 1.52 A 316-432  H-Bb S-Bb L-Bb L-Mj 
4o3p X-ray 1.72 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
4o3q X-ray 1.72 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
4o3o X-ray 1.7 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
4o3r X-ray 1.62 A 316-432  H-Bb S-Bb S-Mj L-Bb 
4q8f X-ray 2.8 A 316-432  H-Bb S-Bb L-Bb 
5dqh X-ray 1.99 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
5dqi X-ray 2.3 A 316-432  H-Bb S-Bb L-Bb L-Mj 
5dgb X-ray 1.79 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
4dl5 X-ray 2.92 A 316-432  H-Bb S-Bb S-Mj L-Bb 
5kfp X-ray 1.7 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
5f9n X-ray 2.23 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
5kfy X-ray 1.7 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
4ru9 X-ray 2.65 A 316-432  H-Bb S-Bb S-Mj L-Bb 
5l1i X-ray 2.78 A 316-432  H-Bb S-Bb L-Bb L-Mj 
6m7t X-ray 2.8 A 316-430  S-Bb L-Bb L-Mj 
4yp3 X-ray 1.89 A 316-432  H-Bb S-Bb S-Mj L-Bb 
5kfl X-ray 1.65 A 316-432  H-Bb S-Bb L-Bb 
5kfk X-ray 1.7 A 316-432  H-Bb S-Bb S-Mj L-Bb 
5dlf X-ray 1.97 A 316-432  H-Bb S-Bb L-Bb 
5l1j X-ray 1.94 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
5kfw X-ray 1.62 A 316-432  H-Bb S-Bb L-Bb 
5l9x X-ray 1.9 A 316-432  H-Bb S-Bb S-Mj L-Bb 
5jum X-ray 2.6 A 316-432  H-Bb S-Bb S-Mj L-Bb 
6ui2 X-ray 2.35 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
5kfd X-ray 1.65 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
5kfo X-ray 1.52 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
5dlg X-ray 2.35 A 316-432  H-Bb S-Bb S-Mj L-Bb 
5kfm X-ray 1.6 A 316-432  H-Bb S-Bb L-Bb 
4q8e X-ray 1.55 A 316-432  H-Bb S-Bb L-Bb L-Mj 
6mq8 X-ray 1.97 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
5f9l X-ray 2.59 A 316-432  H-Bb S-Bb S-Mj L-Bb 
5kfz X-ray 1.44 A 316-432  H-Bb S-Bb L-Bb L-Mj 
5dg9 X-ray 2.15 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
5kg3 X-ray 1.7 A 316-432  H-Bb S-Bb L-Bb L-Mj 
5kfb X-ray 1.55 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
6m7o X-ray 3 A 316-431  H-Bb S-Bb S-Mj L-Bb 
6plc X-ray 2.5 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
5kg7 X-ray 1.75 A 316-432  H-Bb S-Bb L-Bb L-Mj 
4yr0 X-ray 1.78 A 315-431  H-Bb S-Bb L-Bb 
5kfr X-ray 1.75 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
5kg2 X-ray 1.6 A 316-432  H-Bb S-Bb L-Bb L-Mj 
5kg1 X-ray 1.62 A 316-432  H-Bb S-Bb L-Bb L-Mj 
6pl8 X-ray 2.17 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
6pl7 X-ray 2.5 A 316-432  H-Bb S-Bb L-Bb 
5dg8 X-ray 2.12 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
5kfq X-ray 1.55 A 316-432  H-Bb S-Bb L-Bb 
5kff X-ray 1.7 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
5kft X-ray 1.52 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
4yr3 X-ray 2 A 315-431  H-Bb S-Bb S-Mj L-Bb 
4yqw X-ray 2.06 A 316-431  H-Bb S-Bb S-Mj L-Bb 
5kg0 X-ray 1.6 A 316-432  H-Bb S-Bb L-Bb L-Mj 
5kfe X-ray 1.55 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
4yr2 X-ray 1.95 A 315-430  H-Bb S-Bb S-Mj L-Bb L-Mj 
5kfi X-ray 1.65 A 316-432  H-Bb S-Bb S-Mj L-Bb 
5kfs X-ray 1.46 A 316-432  H-Bb S-Bb S-Mj L-Bb 
5ewf X-ray 1.78 A 316-432  H-Bb S-Bb S-Mj L-Bb 
6mxo X-ray 2.04 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
5ewe X-ray 1.66 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
5dga X-ray 2.3 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
5kfh X-ray 1.72 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
5kg5 X-ray 1.6 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
5kfc X-ray 1.5 A 316-432  H-Bb S-Bb S-Mj L-Bb L-Mj 
6m7u X-ray 3.4 A 316-430  S-Bb L-Bb L-Mj 
6uqi X-ray 2.5 A 316-432  S-Bb S-Mj L-Bb L-Mj 
6v5k X-ray 2.69 A 316-432  H-Bb S-Bb S-Mj L-Bb 


© NPIDB team 2003 - 2021

text