Pfam domain
Pfam family: VRR_NUC (PF08774.13)
Uniprot AC: Q9Y2M0
RecName: Fanconi-associated nuclease 1
Begin-End: 893-1008
Organism: Homo sapiens
Interaction Mode:   

Sequence:
APEESLRAWVAATWHEQEGRVASLVSWDRFTSLQQAQDLVSCLGGPVLSGVCRHLAADFR
HCRGGLPDLVVWNSQSRHFKLVEVKGPNDRLSHKQMIWLAELQKLGAEVEVCHVVA
Structures of the domain Q9Y2M0 893-1008
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4rib X-ray 3.25 B 893-1008 None
4rib X-ray 3.25 A 893-1008 None
4rea X-ray 3.81 A 893-1008 None
4rea X-ray 3.81 B 893-1008 None
4reb X-ray 4.2 H 893-1008 None
4reb X-ray 4.2 A 893-1008 None
4rec X-ray 2.2 A 893-1008 None
4ric X-ray 2.8 B 893-1008 None
4ric X-ray 2.8 A 893-1008 None
4ri9 X-ray 2.9 A 893-1008  L-Bb L-Mj 
4ri9 X-ray 2.9 B 893-1008  L-Bb 
4ri8 X-ray 2.9 B 893-1008  H-Bb L-Bb L-Mj 
4ri8 X-ray 2.9 A 893-1008  H-Bb L-Bb L-Mj 
4ria X-ray 3 B 893-1008  L-Bb L-Mj 
4ria X-ray 3 A 893-1008  L-Bb L-Mj 


© NPIDB team 2003 - 2021

text