Pfam domain
Pfam family: RNase_T (PF00929.26)
Uniprot AC: Q9Y3B8
RecName: Oligoribonuclease, mitochondrial
Begin-End: 44-207
Organism: Homo sapiens
Interaction Mode:   

Sequence:
VWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGPNLIIKQPDELLDSMSDWCKEHHGK
SGLTKAVKESTITLQQAEYEFLSFVRQQTPPGLCPLAGNSVHEDKKFLDKYMPQFMKHLH
YRIIDVSTVKELCRRWYPEEYEFAPKKAASHRALDDISESIKEL
Structures of the domain Q9Y3B8 44-207
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6n6k X-ray 1.42 A 12-175 None
6n6k X-ray 1.42 B 12-175 None
6j80 X-ray 1.81 B 44-207 None
6j80 X-ray 1.81 A 77-207 None
6n6i X-ray 1.43 B 12-175 None
6n6i X-ray 1.43 A 12-175 None
6j7y X-ray 2.2 B 44-207 None
6j7y X-ray 2.2 A 67-207 None
6j7z X-ray 2.01 A 83-207 None
6j7z X-ray 2.01 B 44-207 None
6n6j X-ray 1.32 A 12-175 None
6n6j X-ray 1.32 B 12-175 None
6sty X-ray 3.15 A 44-207 None
6sty X-ray 3.15 B 44-207 None
6sty X-ray 3.15 E 44-207 None
6sty X-ray 3.15 D 44-207 None
6rcn X-ray 2.25 A 44-207 None
6rcl X-ray 1.97 A 44-207 None


© NPIDB team 2003 - 2021

text