Pfam domain
Pfam family: SPT16 (PF08644.13)
Uniprot AC: Q9Y5B9
RecName: FACT complex subunit SPT16
Begin-End: 529-689
Organism: Homo sapiens
Interaction Mode:   

Sequence:
IYIDKKYETVIMPVFGIATPFHIATIKNISMSVEGDYTYLRINFYCPGSALGRNEGNIFP
NPEATFVKEITYRASNIKAPGEQTVPALNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQ
DSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRF
Structures of the domain Q9Y5B9 529-689
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6upl X-ray 7.4 G 529-689 None
6upk X-ray 4.9 G 529-689 None


© NPIDB team 2003 - 2021

text