Pfam domain
Pfam family: Rtt106 (PF08512.14)
Uniprot AC: Q9Y5B9
RecName: FACT complex subunit SPT16
Begin-End: 808-895
Organism: Homo sapiens
Interaction Mode:   

Sequence:
GAPYRSTCLLQPTSSALVNATEWPPFVVTLDEVELIHFERVQFHLKNFDMVIVYKDYSKK
VTMINAIPVASLDPIKEWLNSCDLKYTE
Structures of the domain Q9Y5B9 808-895
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6upl X-ray 7.4 G 808-895 None
6upk X-ray 4.9 G 808-895 None


© NPIDB team 2003 - 2021

text