Pfam domain
Pfam family: DM (PF00751.20)
Uniprot AC: Q9Y5R6
RecName: Doublesex- and mab-3-related transcription factor 1
Begin-End: 72-118
Organism: Homo sapiens
Interaction Mode:   

Sequence:
RLPKCARCRNHGYASPLKGHKRFCMWRDCQCKKCNLIAERQRVMAAQ
Structures of the domain Q9Y5R6 72-118
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4yj0 X-ray 3.81 C 72-118  H-Bb H-Mj S-Bb L-Bb L-Mn 
4yj0 X-ray 3.81 B 72-118  H-Bb H-Mj L-Bb L-Mn 
4yj0 X-ray 3.81 A 72-118  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text