Pfam domain
Pfam family: ERCC4 (PF02732.17)
Uniprot AC: Q9YC15
RecName: Repair endonuclease XPF
Begin-End: 17-137
Organism: Aeropyrum pernix
Interaction Mode:  H-Bb H-Mj H-Mn S-Bb 

Sequence:
VDVREERSPVPSILESLGVQVIPKQLPMGDYLVSDSIIVERKTSSDFAKSLFDGRLFEQA
SRLAEHYETVFIIVEGPPVPRRYRGRERSLYAAMAALQLDYGIRLMNTMDPKGTALVIES
L
Structures of the domain Q9YC15 17-137
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2bgw X-ray 2.8 B 23-143  S-Bb 
2bgw X-ray 2.8 A 23-143  H-Bb H-Mj H-Mn 


© NPIDB team 2003 - 2021

text