Pfam domain
Pfam family: DUF4918 (PF16265.7)
Uniprot AC: Q9YGN6
RecName: Single-strand selective monofunctional uracil DNA glycosylase
Begin-End: 66-226
Organism: Xenopus laevis
Interaction Mode:  H-Bb S-Bb L-Bb 

Sequence:
YNPLVYAWAPHENYVQTYCKSKKEVLFLGMNPGPFGMAQTGVPFGEVNHVRDWLQIEGPV
SKPEVEHPKRRIRGFECPQSEVSGARFWSLFKSLCGQPETFFKHCFVHNHCPLIFMNHSG
KNLTPTDLPKAQRDTLLEICDEALCQAVRVLGVKLVIGVGR
Structures of the domain Q9YGN6 66-226
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1oe6 X-ray 2.65 B 66-226  L-Bb 
1oe6 X-ray 2.65 A 66-226  H-Bb 
1oe4 X-ray 2 B 66-226  S-Bb L-Bb 
1oe4 X-ray 2 A 66-226  H-Bb 
1oe5 X-ray 2.3 B 66-226  L-Bb 
1oe5 X-ray 2.3 A 65-225  H-Bb 


© NPIDB team 2003 - 2021

text