Pfam domain
Pfam family: DNA_topoisoIV (PF00521.22)
Uniprot AC: R4YE07
RecName: DNA topoisomerase 4 subunit A
Begin-End: 29-466
Organism: Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Interaction Mode:   

Sequence:
RALPFIGDGLKPVQRRIVYAMSELGLNASAKFKKSARTVGDVLGKYHPHGDSACYEAMVL
MAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTESRLSKYAELLLSELGQGTVDWVPNFD
GTLQEPKMLPARLPNILLNGTTGIAVGMATDIPPHNLREVAKAAITLIEQPKTTLDELLD
IVQGPDFPTEAEIITSRAEIRKIYQNGRGSVRMRAVWSKEDGAVVISALPHQVSGAKVLE
QIAAQMRNKKLPMVDDLRDESDHENPTRLVIVPRSNRVDMEQVMNHLFATTDLEKSYRIN
LNMIGLDGRPAVKNLLEILSEWLVFRRDTVRRRLNHRLEKVLKRLHILEGLLVAFLNIDE
VIEIIRTEDEPKPALMSRFGISETQAEAILELKLRHLAKLEEMKIRGEQSELEKERDQLQ
AILASERKMNNLLKKELQ
Structures of the domain R4YE07 29-466
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5eix X-ray 3.35 B 1029-1465  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 
5eix X-ray 3.35 J 1029-1465  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 
5eix X-ray 3.35 G 1029-1465  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 
5eix X-ray 3.35 A 1029-1465  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 


© NPIDB team 2003 - 2021

text