Pfam domain
Pfam family: Toprim (PF01751.24)
Uniprot AC: R4YHS8
RecName: DNA topoisomerase 4 subunit B
Begin-End: 414-525
Organism: Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Interaction Mode:   

Sequence:
ELFLVEGDSAGGSAKQARDREYQAIMPLKGKILNTWEVSSDEVLASQEVHDISVAIGIDP
DSDDLSQLRYGKICILADADSDGLHIATLLCALFVRHFRTLVKEGHVYVALP
Structures of the domain R4YHS8 414-525
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5eix X-ray 3.35 J 414-522  H-Bb L-Bb L-Mn 
5eix X-ray 3.35 B 414-522  H-Bb L-Bb L-Mn 
5eix X-ray 3.35 G 414-521  H-Bb L-Bb L-Mn 
5eix X-ray 3.35 A 414-522  H-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2021

text