Pfam domain
Pfam family: DNA_gyraseB_C (PF00986.23)
Uniprot AC: R4YHS8
RecName: DNA topoisomerase 4 subunit B
Begin-End: 561-621
Organism: Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Interaction Mode:   

Sequence:
VQRFKGLGEMNPMQLRETTLDPNTRRLVQLVISDEDEQQTTAIMDMLLAKKRSEDRRNWL
Q
Structures of the domain R4YHS8 561-621
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5eix X-ray 3.35 J 552-621  H-Bb 
5eix X-ray 3.35 G 561-621  H-Bb 


© NPIDB team 2003 - 2021

text