Pfam domain
Pfam family: Sigma70_r3 (PF04539.18)
Uniprot AC: S5ZIY8
RecName: RNA polymerase sigma factor RpoS
Begin-End: 173-250
Organism: Salmonella typhimurium
Interaction Mode:   

Sequence:
KELNVYLRTARELSHKLDHEPSAEEIAEQLDKPVDDVSRMLRLNERITSVDTPLGGDSEK
ALLDILADEKENGPEDTT
Structures of the domain S5ZIY8 173-250
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6omf X-ray 3.26 F 173-250  H-Bb 


© NPIDB team 2003 - 2021

text