Pfam domain
Pfam family: Sigma70_r4 (PF04545.18)
Uniprot AC: S5ZIY8
RecName: RNA polymerase sigma factor RpoS
Begin-End: 262-315
Organism: Salmonella typhimurium
Interaction Mode:   

Sequence:
WLFELNAKQREVLARRFGLLGYEAATLEDVGREIGLTRERVRQIQVEGLRRLRE
Structures of the domain S5ZIY8 262-315
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6omf X-ray 3.26 F 262-315  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text