Pfam domain
Pfam family: Sigma70_r1_2 (PF00140.22)
Uniprot AC: S5ZIY8
RecName: RNA polymerase sigma factor RpoS
Begin-End: 56-89
Organism: Salmonella typhimurium
Interaction Mode:   

Sequence:
DATQLYLGEIGYSPLLTAEEEVYFARRALRGDVA
Structures of the domain S5ZIY8 56-89
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6omf X-ray 3.26 F 56-89 None


© NPIDB team 2003 - 2021

text