Pfam domain
Pfam family: Sigma70_r2 (PF04542.16)
Uniprot AC: S5ZIY8
RecName: RNA polymerase sigma factor RpoS
Begin-End: 94-164
Organism: Salmonella typhimurium
Interaction Mode:   

Sequence:
MIESNLRLVVKIARRYGNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQT
IERAIMNQTRT
Structures of the domain S5ZIY8 94-164
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6omf X-ray 3.26 F 94-164  H-Bb H-Mj H-Mn 


© NPIDB team 2003 - 2021

text