Pfam domain
Pfam family: Ribosomal_S9 (PF00380.21)
Uniprot AC: T9TH92
RecName: 30S ribosomal protein S9
Begin-End: 10-130
Organism: Escherichia coli UMEA 3718-1
Interaction Mode:   

Sequence:
GRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKG
GGISGQAGAIRHGITRALMEYDESLRSELRKAGFVTRDARQVERKKVGLRKARRRPQFSK
R
Structures of the domain T9TH92 10-130
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6o7k X-ray 4.2 o 9-129 None


© NPIDB team 2003 - 2021

text