Pfam domain
Pfam family: RNA_pol_Rpb1_1 (PF04997.14)
Uniprot AC: U9YPW3
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 16-342
Organism: Escherichia coli 110957
Interaction Mode:   

Sequence:
EFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLCGKY
KRLKHRGVICEKCGVEVTQTKVRRERMGHIELASPTAHIWFLKSLPSRIGLLLDMPLRDI
ERVLYFESYVVIEGGMTNLERQQILTEEQYLDALEEFGDEFDAKMGAEAIQALLKSMDLE
QECEQLREELNETNSETKRKKLTKRIKLLEAFVQSGNKPEWMILTVLPVLPPDLRPLVPL
DGGRFATSDLNDLYRRVINRNNRLKRLLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGRA
ITGSNKRPLKSLADMIKGKQGRFRQNL
Structures of the domain U9YPW3 16-342
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6oul X-ray 3.4 J 16-342  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text