Pfam domain
Pfam family: RNA_pol_Rpb1_2 (PF00623.22)
Uniprot AC: U9YPW3
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 386-486
Organism: Escherichia coli 110957
Interaction Mode:   

Sequence:
ELRGLATTIKAAKKMVEREEAVVWDILDEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGK
AIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLEARALMMS
Structures of the domain U9YPW3 386-486
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6oul X-ray 3.4 J 386-486 None


© NPIDB team 2003 - 2021

text