Pfam domain
Pfam family: Ribosom_S12_S23 (PF00164.27)
Uniprot AC: V6FZ95
RecName: 30S ribosomal protein S12
Begin-End: 12-123
Organism: Escherichia coli 99.0741
Interaction Mode:   

Sequence:
RARKVAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYIGGEG
HNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGVKRPK
Structures of the domain V6FZ95 12-123
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6o7k X-ray 4.2 t 11-122 None
6nqb X-ray 3.8 L 11-122 None


© NPIDB team 2003 - 2021

text